Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

ICAM-1/CD54 Rabbit mAb (A19300)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - ICAM-1/CD54 Rabbit mAb (A19300)

Western blot analysis of lysates from A-549 cells, using ICAM-1/CD54 Rabbit mAb (A19300) at 1:1000 dilution.A-549 cells were treated by TNF-α (20 ng/mL) at 37℃ for 30 minutes.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit mAb (A19300)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded Human lung cancer using ICAM-1/CD54 Rabbit mAb (A19300) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Flow CytoMetry - ICAM-1/CD54 Rabbit mAb (A19300)

Flow cytometry:1X10^6 293F cells (negative control, left) and Raji cells (right) were surface-stained with ICAM-1/CD54 Rabbit mAb(A19300, 10 μg/mL, green line) or Rabbit IgG isotype control (AC042, 10 μg/mL, blue line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

You may also interested in:

Overview

Product name ICAM-1/CD54 Rabbit mAb
Catalog No. A19300
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0261

Background

This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ICAM-1/CD54 (P05362).
Sequence MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQ
Gene ID 3383
Swiss prot P05362
Synonyms BB2; CD54; P3.58; MALA2; MyD10; ICAM-1/CD54
Calculated MW 58kDa
Observed MW 89kDa/100kDa

Applications

Reactivity Human
Tested applications Testing results
IHC-P Human
WB Human
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • FC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Flow Cytometry    
Positive samples A-549+TNF-α
Cellular location Membrane, Single-pass type I membrane protein
Customer validation

WB (Homo sapiens, Mus musculus)

HE (Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ICAM-1/CD54 Rabbit mAb images

ABclonal:Western blot - ICAM-1/CD54 Rabbit mAb (A19300)}

Western blot - ICAM-1/CD54 Rabbit mAb (A19300)

Western blot analysis of lysates from A-549 cells, using ICAM-1/CD54 Rabbit mAb (A19300) at 1:1000 dilution.A-549 cells were treated by TNF-α (20 ng/mL) at 37℃ for 30 minutes.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
ABclonal:Immunohistochemistry - ICAM-1/CD54 Rabbit mAb (A19300)}

Immunohistochemistry - ICAM-1/CD54 Rabbit mAb (A19300)

Immunohistochemistry analysis of ICAM-1/CD54 in paraffin-embedded Human lung cancer using ICAM-1/CD54 Rabbit mAb (A19300) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Flow CytoMetry - ICAM-1/CD54 Rabbit mAb (A19300)}

Flow CytoMetry - ICAM-1/CD54 Rabbit mAb (A19300)

Flow cytometry:1X10^6 293F cells (negative control, left) and Raji cells (right) were surface-stained with ICAM-1/CD54 Rabbit mAb(A19300, 10 μg/mL, green line) or Rabbit IgG isotype control (AC042, 10 μg/mL, blue line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Inquire About This Product

Submit your question about A19300 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ICAM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ICAM1. (Distance between topics and target gene indicate popularity.) ICAM1

* Data provided by citexs.com, for reference only.

Publishing research using A19300? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order