Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Histone H2AX Rabbit pAb (A11361)

Publications (9) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal:Western blot - Histone H2AX Rabbit pAb (A11361)

Western blot analysis of various lysates using Histone H2AX Rabbit pAb (A11361) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Histone H2AX Rabbit pAb (A11361)

Immunohistochemistry analysis of Histone H2AX in paraffin-embedded human stomach using Histone H2AX Rabbit pAb (A11361) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Histone H2AX Rabbit pAb (A11361)

Immunohistochemistry analysis of Histone H2AX in paraffin-embedded mouse brain using Histone H2AX Rabbit pAb (A11361) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Histone H2AX Rabbit pAb (A11361)

Immunohistochemistry analysis of Histone H2AX in paraffin-embedded rat brain using Histone H2AX Rabbit pAb (A11361) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Histone H2AX Rabbit pAb (A11361)

Confocal immunofluorescence analysis of HeLa cells using Histone H2AX Rabbit pAb (A11361) at dilution of 1:400. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Histone H2AX Rabbit pAb (A11361)

Confocal immunofluorescence analysis of U-2 OS cells using Histone H2AX Rabbit pAb (A11361) at dilution of 1:400. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Histone H2AX Rabbit pAb (A11361)

Immunofluorescence analysis of U2OS cells using Histone H2AX Rabbit pAb (A11361) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Histone H2AX Rabbit pAb
Catalog No. A11361
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-143 of human Histone H2AX (NP_002096.1).
Sequence VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Gene ID 3014
Swiss prot P16104
Synonyms H2A.X; H2A/X; H2AFX; Histone H2AX
Calculated MW 15kDa
Observed MW 16kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:100 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, MCF-7, NIH/3T3, Raji, Mouse testis, Mouse thymus, Rat thymus
Cellular location Chromosome, Nucleus
Customer validation

IHC (Homo sapiens)

WB (Homo sapiens)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Histone H2AX Rabbit pAb images

ABclonal:Western blot - Histone H2AX Rabbit pAb (A11361)}

Western blot - Histone H2AX Rabbit pAb (A11361)

Western blot analysis of various lysates using Histone H2AX Rabbit pAb (A11361) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - Histone H2AX Rabbit pAb (A11361)}

Immunohistochemistry - Histone H2AX Rabbit pAb (A11361)

Immunohistochemistry analysis of Histone H2AX in paraffin-embedded human stomach using Histone H2AX Rabbit pAb (A11361) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Histone H2AX Rabbit pAb (A11361)}

Immunohistochemistry - Histone H2AX Rabbit pAb (A11361)

Immunohistochemistry analysis of Histone H2AX in paraffin-embedded mouse brain using Histone H2AX Rabbit pAb (A11361) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Histone H2AX Rabbit pAb (A11361)}

Immunohistochemistry - Histone H2AX Rabbit pAb (A11361)

Immunohistochemistry analysis of Histone H2AX in paraffin-embedded rat brain using Histone H2AX Rabbit pAb (A11361) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Histone H2AX Rabbit pAb (A11361)}

Immunofluorescence - Histone H2AX Rabbit pAb (A11361)

Confocal immunofluorescence analysis of HeLa cells using Histone H2AX Rabbit pAb (A11361) at dilution of 1:400. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Histone H2AX Rabbit pAb (A11361)}

Immunofluorescence - Histone H2AX Rabbit pAb (A11361)

Confocal immunofluorescence analysis of U-2 OS cells using Histone H2AX Rabbit pAb (A11361) at dilution of 1:400. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Histone H2AX Rabbit pAb (A11361)}

Immunofluorescence - Histone H2AX Rabbit pAb (A11361)

Immunofluorescence analysis of U2OS cells using Histone H2AX Rabbit pAb (A11361) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11361 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on H2AX. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to H2AX. (Distance between topics and target gene indicate popularity.) H2AX

* Data provided by citexs.com, for reference only.

Publishing research using A11361? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Alternative Products
Contact us to order