Publication (1) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Product name | Histone H2AX Rabbit pAb |
---|---|
Catalog No. | A11097 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-143 of human Histone H2AX (NP_002096.1). |
---|---|
Sequence | VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY |
Gene ID | 3014 |
Swiss prot | P16104 |
Synonyms | H2A.X; H2A/X; H2AFX; Histone H2AX |
Calculated MW | 15kDa |
Observed MW | 15kDa |
Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293T, NIH/3T3, C2C12, Jurkat, Raji, Rat thymus |
Cellular location | Chromosome, Nucleus |
Customer validation | WB (Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A11097 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on H2AX. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to H2AX. (Distance between topics and target gene indicate popularity.) H2AX
* Data provided by citexs.com, for reference only.
Publishing research using A11097? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.