Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HTRA3 Rabbit pAb (A14649)

Reviews (2) Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - HTRA3 Rabbit pAb (A14649)

Western blot analysis of extracts of various cell lines, using HTRA3 antibody (A14649) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Review
ABclonal: review for HTRA3 Rabbit pAb(A14649)
Review
ABclonal: review for HTRA3 Rabbit pAb(A14649)

You may also interested in:

Overview

Product name HTRA3 Rabbit pAb
Catalog No. A14649
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables endopeptidase activity; identical protein binding activity; and serine-type peptidase activity. Involved in proteolysis. Predicted to be located in extracellular region.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 334-453 of human HTRA3 (NP_444272.1).
Sequence SDRITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM
Gene ID 94031
Swiss prot P83110
Synonyms Prsp; Tasp; HTRA3
Calculated MW 49kDa
Observed MW 49kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, SKOV3, Mouse brain
Cellular location Secreted
Customer validation

WB (human cellsHomo sapiens)

IHC (Rat bone tissue)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HTRA3 Rabbit pAb images

ABclonal:Western blot - HTRA3 Rabbit pAb (A14649)}

Western blot - HTRA3 Rabbit pAb (A14649)

Western blot analysis of extracts of various cell lines, using HTRA3 antibody (A14649) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Submit an review for A14649

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A14649 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HTRA3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HTRA3. (Distance between topics and target gene indicate popularity.) HTRA3

* Data provided by citexs.com, for reference only.

Publishing research using A14649? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order