Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HTRA2 Rabbit pAb (A5762)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - HTRA2 Rabbit pAb (A5762)

Western blot analysis of various lysates using HTRA2 Rabbit pAb (A5762) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).

ABclonal:Immunofluorescence - HTRA2 Rabbit pAb (A5762)

Immunofluorescence analysis of HeLa cells using HTRA2 Rabbit pAb (A5762). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name HTRA2 Rabbit pAb
Catalog No. A5762
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 334-458 of human HTRA2 (NP_037379.1).
Sequence PSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Gene ID 27429
Swiss prot O43464
Synonyms OMI; MGCA8; PARK13; PRSS25; HTRA2
Calculated MW 49kDa
Observed MW 37kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples SW480, HT-29, MCF7, HL-60, Mouse heart, Mouse kidney
Cellular location Mitochondrion intermembrane space, Mitochondrion membrane, Single-pass membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HTRA2 Rabbit pAb images

ABclonal:Western blot - HTRA2 Rabbit pAb (A5762)}

Western blot - HTRA2 Rabbit pAb (A5762)

Western blot analysis of various lysates using HTRA2 Rabbit pAb (A5762) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
ABclonal:Immunofluorescence - HTRA2 Rabbit pAb (A5762)}

Immunofluorescence - HTRA2 Rabbit pAb (A5762)

Immunofluorescence analysis of HeLa cells using HTRA2 Rabbit pAb (A5762). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5762 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HTRA2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HTRA2. (Distance between topics and target gene indicate popularity.) HTRA2

* Data provided by citexs.com, for reference only.

Publishing research using A5762? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order