Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HSF2BP Rabbit pAb (A10603)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - HSF2BP Rabbit pAb (A10603)

Western blot analysis of extracts of mouse testis, using HSF2BP Antibody (A10603) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunofluorescence - HSF2BP Rabbit pAb (A10603)

Immunofluorescence analysis of L929 cells using HSF2BP Rabbit pAb (A10603) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name HSF2BP Rabbit pAb
Catalog No. A10603
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Involved in meiosis I and spermatogenesis. Located in chromosome. Is expressed in several structures, including genitourinary system; nervous system; sensory organ; surface ectoderm; and thymus. Human ortholog(s) of this gene implicated in primary ovarian insufficiency 19. Orthologous to human HSF2BP (heat shock transcription factor 2 binding protein).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-338 of mouse HSF2BP (NP_083178.1).
Sequence MAATVGDGSGTEEACRNMESKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGELLESFQKLKMVEKNLERKEQELEQLIMDREHFKARLETAQADSGREKKEKLALRQQLNEAKQQLLQQAEYCTQMGAVTCTLLWGVSSSEEVVKTILGGDKALKFFNITGQTMESFVKSLDGDVKEVDSDENQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTMLQLLGDLKPGQCTKLKVLMLMSLYNVSINSKGLKYITESPGFIPLLWWLLSDPDAEVCLHTLRLIQSVVLEPDVFSKVASELQSSLPLQRILAMSKSRNSHLQSAAQELLEDLRALDCNV
Gene ID 74377
Swiss prot
Synonyms Meilb2; 4932437G14Rik; HSF2BP
Calculated MW 37kDa
Observed MW 38kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse testis
Cellular location

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

HSF2BP Rabbit pAb images

ABclonal:Western blot - HSF2BP Rabbit pAb (A10603)}

Western blot - HSF2BP Rabbit pAb (A10603)

Western blot analysis of extracts of mouse testis, using HSF2BP Antibody (A10603) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Immunofluorescence - HSF2BP Rabbit pAb (A10603)}

Immunofluorescence - HSF2BP Rabbit pAb (A10603)

Immunofluorescence analysis of L929 cells using HSF2BP Rabbit pAb (A10603) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A10603 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Hsf2bp. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Hsf2bp. (Distance between topics and target gene indicate popularity.) Hsf2bp

* Data provided by citexs.com, for reference only.

Publishing research using A10603? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order