Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HDAC5 Rabbit pAb (A7189)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - HDAC5 Rabbit pAb (A7189)

Western blot analysis of extracts of various cell lines, using HDAC5 antibody (A7189) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - HDAC5 Rabbit pAb (A7189)

Immunofluorescence analysis of A549 cells using HDAC5 antibody (A7189). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name HDAC5 Rabbit pAb
Catalog No. A7189
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the class II histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. It coimmunoprecipitates only with HDAC3 family member and might form multicomplex proteins. It also interacts with myocyte enhancer factor-2 (MEF2) proteins, resulting in repression of MEF2-dependent genes. This gene is thought to be associated with colon cancer. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human HDAC5 (NP_005465.2).
Sequence RALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLL
Gene ID 10014
Swiss prot Q9UQL6
Synonyms HD5; NY-CO-9; HDAC5
Calculated MW 122kDa
Observed MW 121kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:20 - 1:50
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HepG2, SW620, THP-1, HeLa
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HDAC5 Rabbit pAb images

ABclonal:Western blot - HDAC5 Rabbit pAb (A7189)}

Western blot - HDAC5 Rabbit pAb (A7189)

Western blot analysis of extracts of various cell lines, using HDAC5 antibody (A7189) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunofluorescence - HDAC5 Rabbit pAb (A7189)}

Immunofluorescence - HDAC5 Rabbit pAb (A7189)

Immunofluorescence analysis of A549 cells using HDAC5 antibody (A7189). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7189 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HDAC5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HDAC5. (Distance between topics and target gene indicate popularity.) HDAC5

* Data provided by citexs.com, for reference only.

Publishing research using A7189? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order