Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HRAS Rabbit pAb (A7901)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - HRAS Rabbit pAb (A7901)

Western blot analysis of extracts of various cell lines, using HRAS antibody (A7901) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 20s.

ABclonal:Immunohistochemistry - HRAS Rabbit pAb (A7901)

Immunohistochemistry analysis of paraffin-embedded human gastric using HRAS antibody (A7901) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - HRAS Rabbit pAb (A7901)

Immunohistochemistry analysis of paraffin-embedded human gastric cancer using HRAS antibody (A7901) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name HRAS Rabbit pAb
Catalog No. A7901
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, cognitive disability, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HRAS (NP_203524.1).
Sequence MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQI
Gene ID 3265
Swiss prot P01112
Synonyms CTLO; HAMSV; HRAS1; RASH1; p21ras; C-H-RAS; H-RASIDX; C-BAS/HAS; C-HA-RAS1; HRAS
Calculated MW 21kDa
Observed MW 21kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples SKOV3, Mouse brain, Mouse skeletal muscle, Mouse kidney, Rat brain
Cellular location Cell membrane, Cytoplasm, Cytoplasmic side, Golgi apparatus, Golgi apparatus membrane, Lipid-anchor, Lipid-anchor, Nucleus, perinuclear region
Customer validation

WB (Mus musculus, Gallus gallus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HRAS Rabbit pAb images

ABclonal:Western blot - HRAS Rabbit pAb (A7901)}

Western blot - HRAS Rabbit pAb (A7901)

Western blot analysis of extracts of various cell lines, using HRAS antibody (A7901) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 20s.
ABclonal:Immunohistochemistry - HRAS Rabbit pAb (A7901)}

Immunohistochemistry - HRAS Rabbit pAb (A7901)

Immunohistochemistry analysis of paraffin-embedded human gastric using HRAS antibody (A7901) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - HRAS Rabbit pAb (A7901)}

Immunohistochemistry - HRAS Rabbit pAb (A7901)

Immunohistochemistry analysis of paraffin-embedded human gastric cancer using HRAS antibody (A7901) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A7901 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HRAS. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HRAS. (Distance between topics and target gene indicate popularity.) HRAS

* Data provided by citexs.com, for reference only.

Publishing research using A7901? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order