Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GST3/GSTP1 Rabbit pAb (A5691)

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - GST3/GSTP1 Rabbit pAb (A5691)

Western blot analysis of extracts of various cell lines, using GST3/GST3/GSTP1 antibody (A5691) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - GST3/GSTP1 Rabbit pAb (A5691)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using GST3/GST3/GSTP1 antibody (A5691) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GST3/GSTP1 Rabbit pAb (A5691)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using GST3/GST3/GSTP1 antibody (A5691) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - GST3/GSTP1 Rabbit pAb (A5691)

Immunofluorescence analysis of L929 cells using GST3/GST3/GSTP1 Rabbit pAb (A5691) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name GST3/GSTP1 Rabbit pAb
Catalog No. A5691
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human GST3/GST3/GSTP1 (NP_000843.1).
Sequence MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Gene ID 2950
Swiss prot P09211
Synonyms PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22; GST3/GSTP1
Calculated MW 23kDa
Observed MW 25kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SW620, HL-60, HT-29, 293T, U-251MG, Mouse kidney
Cellular location Cytoplasm, Mitochondrion, Nucleus
Customer validation

WB (Homo sapiens, Sus scrofa, Mus musculus)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GST3/GSTP1 Rabbit pAb images

ABclonal:Western blot - GST3/GSTP1 Rabbit pAb (A5691)}

Western blot - GST3/GSTP1 Rabbit pAb (A5691)

Western blot analysis of extracts of various cell lines, using GST3/GST3/GSTP1 antibody (A5691) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - GST3/GSTP1 Rabbit pAb (A5691)}

Immunohistochemistry - GST3/GSTP1 Rabbit pAb (A5691)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using GST3/GST3/GSTP1 antibody (A5691) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GST3/GSTP1 Rabbit pAb (A5691)}

Immunohistochemistry - GST3/GSTP1 Rabbit pAb (A5691)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using GST3/GST3/GSTP1 antibody (A5691) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - GST3/GSTP1 Rabbit pAb (A5691)}

Immunofluorescence - GST3/GSTP1 Rabbit pAb (A5691)

Immunofluorescence analysis of L929 cells using GST3/GST3/GSTP1 Rabbit pAb (A5691) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5691 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GSTP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GSTP1. (Distance between topics and target gene indicate popularity.) GSTP1

* Data provided by citexs.com, for reference only.

Publishing research using A5691? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order