Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GOT1 Rabbit pAb (A5822)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - GOT1 Rabbit pAb (A5822)

Western blot analysis of extracts of various cell lines, using GOT1 antibody (A5822) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - GOT1 Rabbit pAb (A5822)

Immunohistochemistry analysis of paraffin-embedded rat heart using GOT1 antibody (A5822) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GOT1 Rabbit pAb (A5822)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using GOT1 antibody (A5822) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GOT1 Rabbit pAb (A5822)

Immunohistochemistry analysis of paraffin-embedded human colon using GOT1 antibody (A5822) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - GOT1 Rabbit pAb (A5822)

Immunofluorescence analysis of U2OS cells using GOT1 antibody (A5822). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name GOT1 Rabbit pAb
Catalog No. A5822
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 244-413 of human GOT1 (NP_002070.1).
Sequence FVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ
Gene ID 2805
Swiss prot P17174
Synonyms AST; AST1; SGOT; cCAT; GIG18; cAspAT; ASTQTL1; GOT1
Calculated MW 46kDa
Observed MW 41kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:10 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HepG2, Mouse brain, Mouse liver, Mouse heart, Rat brain, Rat liver
Cellular location Cytoplasm
Customer validation

WB (Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GOT1 Rabbit pAb images

ABclonal:Western blot - GOT1 Rabbit pAb (A5822)}

Western blot - GOT1 Rabbit pAb (A5822)

Western blot analysis of extracts of various cell lines, using GOT1 antibody (A5822) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - GOT1 Rabbit pAb (A5822)}

Immunohistochemistry - GOT1 Rabbit pAb (A5822)

Immunohistochemistry analysis of paraffin-embedded rat heart using GOT1 antibody (A5822) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GOT1 Rabbit pAb (A5822)}

Immunohistochemistry - GOT1 Rabbit pAb (A5822)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using GOT1 antibody (A5822) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GOT1 Rabbit pAb (A5822)}

Immunohistochemistry - GOT1 Rabbit pAb (A5822)

Immunohistochemistry analysis of paraffin-embedded human colon using GOT1 antibody (A5822) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - GOT1 Rabbit pAb (A5822)}

Immunofluorescence - GOT1 Rabbit pAb (A5822)

Immunofluorescence analysis of U2OS cells using GOT1 antibody (A5822). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5822 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GOT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GOT1. (Distance between topics and target gene indicate popularity.) GOT1

* Data provided by citexs.com, for reference only.

Publishing research using A5822? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order