Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GOSR1 Rabbit pAb (A4316)

Publications (2) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - GOSR1 Rabbit pAb (A4316)

Western blot analysis of extracts of mouse testis, using GOSR1 antibody (A4316) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 15s.

You may also interested in:

Overview

Product name GOSR1 Rabbit pAb
Catalog No. A4316
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human GOSR1 (NP_004862.1).
Sequence MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDIL
Gene ID 9527
Swiss prot O95249
Synonyms P28; GS28; GOS28; GOLIM2; GOS-28; GOS28/P28; GOSR1
Calculated MW 29kDa
Observed MW 29kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse testis
Cellular location Golgi apparatus membrane, Single-pass type IV membrane protein
Customer validation

IF (Sus scrofa, Chlorocebus aethiops)

GOSR1 Rabbit pAb images

ABclonal:Western blot - GOSR1 Rabbit pAb (A4316)}

Western blot - GOSR1 Rabbit pAb (A4316)

Western blot analysis of extracts of mouse testis, using GOSR1 antibody (A4316) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 15s.

Inquire About This Product

Submit your question about A4316 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GOSR1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GOSR1. (Distance between topics and target gene indicate popularity.) GOSR1

* Data provided by citexs.com, for reference only.

Publishing research using A4316? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order