Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GLI3 Rabbit pAb (A15613)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunohistochemistry - GLI3 Rabbit pAb (A15613)

Immunohistochemistry analysis of paraffin-embedded human colon using GLI3 Rabbit pAb (A15613) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GLI3 Rabbit pAb (A15613)

Immunohistochemistry analysis of paraffin-embedded mouse liver using GLI3 Rabbit pAb (A15613) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GLI3 Rabbit pAb (A15613)

Immunohistochemistry analysis of paraffin-embedded rat brain using GLI3 Rabbit pAb (A15613) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GLI3 Rabbit pAb (A15613)

Immunohistochemistry analysis of paraffin-embedded rat ovary using GLI3 Rabbit pAb (A15613) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name GLI3 Rabbit pAb
Catalog No. A15613
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 681-788 of human GLI3 (NP_000159.3).
Sequence NTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKLERLKQVNG
Gene ID 2737
Swiss prot P10071
Synonyms PHS; ACLS; GCPS; PAPA; PAPB; PAP-A; PAPA1; PPDIV; GLI3FL; GLI3-190; GLI3
Calculated MW 170kDa
Observed MW Refer to figures

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Immunohistochemistry    
Positive samples Mouse thymus, Rat thymus
Cellular location axoneme, ciliary base, ciliary tip, cilium, cytoplasm, cytosol, GLI-SUFU complex, nuclear speck, nucleolus, nucleoplasm, nucleus
Customer validation

WB (Homo sapiens, Drosophila melanogaster)

IP (Drosophila melanogaster)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GLI3 Rabbit pAb images

ABclonal:Immunohistochemistry - GLI3 Rabbit pAb (A15613)}

Immunohistochemistry - GLI3 Rabbit pAb (A15613)

Immunohistochemistry analysis of paraffin-embedded human colon using GLI3 Rabbit pAb (A15613) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GLI3 Rabbit pAb (A15613)}

Immunohistochemistry - GLI3 Rabbit pAb (A15613)

Immunohistochemistry analysis of paraffin-embedded mouse liver using GLI3 Rabbit pAb (A15613) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GLI3 Rabbit pAb (A15613)}

Immunohistochemistry - GLI3 Rabbit pAb (A15613)

Immunohistochemistry analysis of paraffin-embedded rat brain using GLI3 Rabbit pAb (A15613) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GLI3 Rabbit pAb (A15613)}

Immunohistochemistry - GLI3 Rabbit pAb (A15613)

Immunohistochemistry analysis of paraffin-embedded rat ovary using GLI3 Rabbit pAb (A15613) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A15613 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GLI3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GLI3. (Distance between topics and target gene indicate popularity.) GLI3

* Data provided by citexs.com, for reference only.

Publishing research using A15613? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order