Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Connexin 43 Rabbit pAb (A2163)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Connexin 43 Rabbit pAb (A2163)

Western blot analysis of extracts of various cell lines, using Connexin 43 antibody (A2163) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - Connexin 43 Rabbit pAb (A2163)

Western blot analysis of extracts of Rat brain, using Connexin 43 antibody (A2163) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name Connexin 43 Rabbit pAb
Catalog No. A2163
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia, autosomal recessive craniometaphyseal dysplasia and heart malformations.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 283-382 of human Connexin 43 (NP_000156.1).
Sequence PPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Gene ID 2697
Swiss prot P17302
Synonyms HSS; CMDR; CX43; EKVP; GJAL; ODDD; AVSD3; EKVP3; HLHS1; PPKCA; Connexin 43
Calculated MW 43kDa
Observed MW 43kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG, Jurkat, Mouse brain, Rat brain
Cellular location Cell junction, Cell membrane, Endoplasmic reticulum, Multi-pass membrane protein, gap junction
Customer validation

WB (Rattus norvegicus)

IF (Rattus norvegicus)

RT-qPCR (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Connexin 43 Rabbit pAb images

ABclonal:Western blot - Connexin 43 Rabbit pAb (A2163)}

Western blot - Connexin 43 Rabbit pAb (A2163)

Western blot analysis of extracts of various cell lines, using Connexin 43 antibody (A2163) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - Connexin 43 Rabbit pAb (A2163)}

Western blot - Connexin 43 Rabbit pAb (A2163)

Western blot analysis of extracts of Rat brain, using Connexin 43 antibody (A2163) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A2163 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GJA1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GJA1. (Distance between topics and target gene indicate popularity.) GJA1

* Data provided by citexs.com, for reference only.

Publishing research using A2163? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order