Publications (2) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Connexin 43 Rabbit pAb |
---|---|
Catalog No. | A2163 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 283-382 of human Connexin 43 (NP_000156.1). |
---|---|
Sequence | PPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI |
Gene ID | 2697 |
Swiss prot | P17302 |
Synonyms | HSS; CMDR; CX43; EKVP; GJAL; ODDD; AVSD3; EKVP3; HLHS1; PPKCA; Connexin 43 |
Calculated MW | 43kDa |
Observed MW | 43kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | U-87MG, Jurkat, Mouse brain, Rat brain |
Cellular location | Cell junction, Cell membrane, Endoplasmic reticulum, Multi-pass membrane protein, gap junction |
Customer validation | WB (Rattus norvegicus) IF (Rattus norvegicus) RT-qPCR (Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A2163 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on GJA1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to GJA1. (Distance between topics and target gene indicate popularity.) GJA1
* Data provided by citexs.com, for reference only.
Publishing research using A2163? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.