Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GIPR Rabbit pAb (A9816)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - GIPR Rabbit pAb (A9816)

Western blot analysis of extracts of various cell lines, using GIPR antibody (A9816) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

ABclonal:Immunohistochemistry - GIPR Rabbit pAb (A9816)

Immunohistochemistry analysis of paraffin-embedded rat brain using GIPR Rabbit pAb (A9816) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name GIPR Rabbit pAb
Catalog No. A9816
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a G-protein coupled receptor for gastric inhibitory polypeptide (GIP), which was originally identified as an activity in gut extracts that inhibited gastric acid secretion and gastrin release, but subsequently was demonstrated to stimulate insulin release in the presence of elevated glucose. Mice lacking this gene exhibit higher blood glucose levels with impaired initial insulin response after oral glucose load. Defect in this gene thus may contribute to the pathogenesis of diabetes.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-138 of human GIPR (NP_000155.1).
Sequence RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
Gene ID 2696
Swiss prot P48546
Synonyms PGQTL2; GIPR
Calculated MW 53kDa
Observed MW 45kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples K-562, Mouse liver, Rat heart, Rat brain
Cellular location Cell membrane, Multi-pass membrane protein
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GIPR Rabbit pAb images

ABclonal:Western blot - GIPR Rabbit pAb (A9816)}

Western blot - GIPR Rabbit pAb (A9816)

Western blot analysis of extracts of various cell lines, using GIPR antibody (A9816) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.
ABclonal:Immunohistochemistry - GIPR Rabbit pAb (A9816)}

Immunohistochemistry - GIPR Rabbit pAb (A9816)

Immunohistochemistry analysis of paraffin-embedded rat brain using GIPR Rabbit pAb (A9816) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A9816 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GIPR. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GIPR. (Distance between topics and target gene indicate popularity.) GIPR

* Data provided by citexs.com, for reference only.

Publishing research using A9816? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order