Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GGT1 Rabbit pAb (A1776)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - GGT1 Rabbit pAb (A1776)

Western blot analysis of extracts of various cell lines, using GGT1 antibody (A1776) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - GGT1 Rabbit pAb (A1776)

Immunohistochemistry analysis of paraffin-embedded rat kidney using GGT1 antibody (A1776) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GGT1 Rabbit pAb (A1776)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using GGT1 antibody (A1776) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GGT1 Rabbit pAb (A1776)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using GGT1 antibody (A1776) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name GGT1 Rabbit pAb
Catalog No. A1776
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The enzyme encoded by this gene is a type I gamma-glutamyltransferase that catalyzes the transfer of the glutamyl moiety of glutathione to a variety of amino acids and dipeptide acceptors. The enzyme is composed of a heavy chain and a light chain, which are derived from a single precursor protein. It is expressed in tissues involved in absorption and secretion and may contribute to the etiology of diabetes and other metabolic disorders. Multiple alternatively spliced variants have been identified. There are a number of related genes present on chromosomes 20 and 22, and putative pseudogenes for this gene on chromosomes 2, 13, and 22.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 370-569 of human GGT1 (NP_038265.2?).
Sequence KPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY
Gene ID 2678
Swiss prot P19440
Synonyms GGT; GTG; GGTD; CD224; GGT 1; D22S672; D22S732; GGT1
Calculated MW 61KDa/39KDa/24KDa
Observed MW 25KDa/75KDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Jurkat, Mouse kidney
Cellular location Cell membrane, Single-pass type II membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GGT1 Rabbit pAb images

ABclonal:Western blot - GGT1 Rabbit pAb (A1776)}

Western blot - GGT1 Rabbit pAb (A1776)

Western blot analysis of extracts of various cell lines, using GGT1 antibody (A1776) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Immunohistochemistry - GGT1 Rabbit pAb (A1776)}

Immunohistochemistry - GGT1 Rabbit pAb (A1776)

Immunohistochemistry analysis of paraffin-embedded rat kidney using GGT1 antibody (A1776) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GGT1 Rabbit pAb (A1776)}

Immunohistochemistry - GGT1 Rabbit pAb (A1776)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using GGT1 antibody (A1776) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GGT1 Rabbit pAb (A1776)}

Immunohistochemistry - GGT1 Rabbit pAb (A1776)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using GGT1 antibody (A1776) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1776 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GGT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GGT1. (Distance between topics and target gene indicate popularity.) GGT1

* Data provided by citexs.com, for reference only.

Publishing research using A1776? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order