Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GADD45G Rabbit pAb (A10286)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - GADD45G Rabbit pAb (A10286)

Western blot analysis of lysates from RAW264.7 cells, using GADD45G Rabbit pAb (A10286) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.

ABclonal:Immunohistochemistry - GADD45G Rabbit pAb (A10286)

Immunohistochemistry analysis of GADD45G in paraffin-embedded rat brain tissue using GADD45G Rabbit pAb (A10286) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - GADD45G Rabbit pAb (A10286)

Immunohistochemistry analysis of GADD45G in paraffin-embedded rat testis tissue using GADD45G Rabbit pAb (A10286) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - GADD45G Rabbit pAb (A10286)

Immunohistochemistry analysis of GADD45G in paraffin-embedded human colon carcinoma tissue using GADD45G Rabbit pAb (A10286) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - GADD45G Rabbit pAb (A10286)

Immunohistochemistry analysis of GADD45G in paraffin-embedded human pancreas tissue using GADD45G Rabbit pAb (A10286) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - GADD45G Rabbit pAb (A10286)

Immunohistochemistry analysis of GADD45G in paraffin-embedded mouse pancreas tissue using GADD45G Rabbit pAb (A10286) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

You may also interested in:

Overview

Product name GADD45G Rabbit pAb
Catalog No. A10286
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 90-159 of human GADD45G (NP_006696.1).
Sequence IDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Gene ID 10912
Swiss prot O95257
Synonyms CR6; DDIT2; GRP17; GADD45gamma; GADD45G
Calculated MW 17kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples RAW264.7
Cellular location cytoplasm, nucleus
Customer validation

WB (Homo sapiens, Mus musculus)

IHC (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GADD45G Rabbit pAb images

ABclonal:Western blot - GADD45G Rabbit pAb (A10286)}

Western blot - GADD45G Rabbit pAb (A10286)

Western blot analysis of lysates from RAW264.7 cells, using GADD45G Rabbit pAb (A10286) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.
ABclonal:Immunohistochemistry - GADD45G Rabbit pAb (A10286)}

Immunohistochemistry - GADD45G Rabbit pAb (A10286)

Immunohistochemistry analysis of GADD45G in paraffin-embedded rat brain tissue using GADD45G Rabbit pAb (A10286) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - GADD45G Rabbit pAb (A10286)}

Immunohistochemistry - GADD45G Rabbit pAb (A10286)

Immunohistochemistry analysis of GADD45G in paraffin-embedded rat testis tissue using GADD45G Rabbit pAb (A10286) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - GADD45G Rabbit pAb (A10286)}

Immunohistochemistry - GADD45G Rabbit pAb (A10286)

Immunohistochemistry analysis of GADD45G in paraffin-embedded human colon carcinoma tissue using GADD45G Rabbit pAb (A10286) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - GADD45G Rabbit pAb (A10286)}

Immunohistochemistry - GADD45G Rabbit pAb (A10286)

Immunohistochemistry analysis of GADD45G in paraffin-embedded human pancreas tissue using GADD45G Rabbit pAb (A10286) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - GADD45G Rabbit pAb (A10286)}

Immunohistochemistry - GADD45G Rabbit pAb (A10286)

Immunohistochemistry analysis of GADD45G in paraffin-embedded mouse pancreas tissue using GADD45G Rabbit pAb (A10286) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Inquire About This Product

Submit your question about A10286 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GADD45G. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GADD45G. (Distance between topics and target gene indicate popularity.) GADD45G

* Data provided by citexs.com, for reference only.

Publishing research using A10286? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order