Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FOXL2 Rabbit pAb (A16244)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - FOXL2 Rabbit pAb (A16244)

Western blot analysis of extracts of various cell lines, using (A16244) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - FOXL2 Rabbit pAb (A16244)

Immunofluorescence analysis of rat ovary using FOXL2 Rabbit pAb (A16244) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - FOXL2 Rabbit pAb (A16244)

Immunofluorescence analysis of mouse ovary using FOXL2 Rabbit pAb (A16244) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name FOXL2 Rabbit pAb
Catalog No. A16244
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a forkhead transcription factor. The protein contains a fork-head DNA-binding domain and may play a role in ovarian development and function. Expansion of a polyalanine repeat region and other mutations in this gene are a cause of blepharophimosis syndrome and premature ovarian failure 3.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-376 of human FOXL2 (NP_075555.1).
Sequence HAAAAPPPAPPHHGAAAPPPGQLSPASPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLDL
Gene ID 668
Swiss prot P58012
Synonyms BPES; PFRK; POF3; BPES1; PINTO; FOXL2
Calculated MW 39kDa
Observed MW 50kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples OVCAR3, PC-3
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FOXL2 Rabbit pAb images

ABclonal:Western blot - FOXL2 Rabbit pAb (A16244)}

Western blot - FOXL2 Rabbit pAb (A16244)

Western blot analysis of extracts of various cell lines, using (A16244) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunofluorescence - FOXL2 Rabbit pAb (A16244)}

Immunofluorescence - FOXL2 Rabbit pAb (A16244)

Immunofluorescence analysis of rat ovary using FOXL2 Rabbit pAb (A16244) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - FOXL2 Rabbit pAb (A16244)}

Immunofluorescence - FOXL2 Rabbit pAb (A16244)

Immunofluorescence analysis of mouse ovary using FOXL2 Rabbit pAb (A16244) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A16244 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FOXL2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FOXL2. (Distance between topics and target gene indicate popularity.) FOXL2

* Data provided by citexs.com, for reference only.

Publishing research using A16244? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order