Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

VEGFR3/FLT4 Rabbit pAb (A13304)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunofluorescence - VEGFR3/FLT4 Rabbit pAb (A13304)

Immunofluorescence analysis of MCF7 cells using VEGFR3/FLT4 Rabbit pAb (A13304) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name VEGFR3/FLT4 Rabbit pAb
Catalog No. A13304
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1174-1363 of human VEGFR3/FLT4 (NP_891555.2).
Sequence QGRGLQEEEEVCMAPRSSQSSEEGSFSQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCKGPGQNVAVTRAHPDSQGRRRRPERGARGGQVFYNSEYGELSEPSEEDHCSPSARVTFFTDNSY
Gene ID 2324
Swiss prot P35916
Synonyms PCL; CHTD7; FLT-4; FLT41; LMPH1A; LMPHM1; VEGFR3; VEGFR-3; VEGFR3/FLT4
Calculated MW 153kDa
Observed MW 178kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Immunofluorescence    
Positive samples Rat lung
Cellular location Cell membrane, Cytoplasm, Nucleus, Secreted, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

VEGFR3/FLT4 Rabbit pAb images

ABclonal:Immunofluorescence - VEGFR3/FLT4 Rabbit pAb (A13304)}

Immunofluorescence - VEGFR3/FLT4 Rabbit pAb (A13304)

Immunofluorescence analysis of MCF7 cells using VEGFR3/FLT4 Rabbit pAb (A13304) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A13304 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FLT4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FLT4. (Distance between topics and target gene indicate popularity.) FLT4

* Data provided by citexs.com, for reference only.

Publishing research using A13304? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order