Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FGFR3 Rabbit pAb (A0404)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - FGFR3 Rabbit pAb (A0404)

Western blot analysis of extracts of Rat brain, using FGFR3 antibody (A0404) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - FGFR3 Rabbit pAb (A0404)

Immunofluorescence analysis of NIH/3T3 cells using FGFR3 Rabbit pAb (A0404) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - FGFR3 Rabbit pAb (A0404)

Immunofluorescence analysis of PC-12 cells using FGFR3 Rabbit pAb (A0404) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - FGFR3 Rabbit pAb (A0404)

Immunofluorescence analysis of U2OS cells using FGFR3 Rabbit pAb (A0404) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name FGFR3 Rabbit pAb
Catalog No. A0404
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-806 of human FGFR3 (NP_000133.1).
Sequence VEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT
Gene ID 2261
Swiss prot P22607
Synonyms ACH; CEK2; JTK4; CD333; HSFGFR3EX; FGFR3
Calculated MW 88kDa
Observed MW 125kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:100
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Rat brain
Cellular location Cell membrane, Cytoplasmic vesicle, Endoplasmic reticulum, Secreted, Single-pass type I membrane protein
Customer validation

WB (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FGFR3 Rabbit pAb images

ABclonal:Western blot - FGFR3 Rabbit pAb (A0404)}

Western blot - FGFR3 Rabbit pAb (A0404)

Western blot analysis of extracts of Rat brain, using FGFR3 antibody (A0404) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - FGFR3 Rabbit pAb (A0404)}

Immunofluorescence - FGFR3 Rabbit pAb (A0404)

Immunofluorescence analysis of NIH/3T3 cells using FGFR3 Rabbit pAb (A0404) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - FGFR3 Rabbit pAb (A0404)}

Immunofluorescence - FGFR3 Rabbit pAb (A0404)

Immunofluorescence analysis of PC-12 cells using FGFR3 Rabbit pAb (A0404) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - FGFR3 Rabbit pAb (A0404)}

Immunofluorescence - FGFR3 Rabbit pAb (A0404)

Immunofluorescence analysis of U2OS cells using FGFR3 Rabbit pAb (A0404) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0404 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FGFR3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FGFR3. (Distance between topics and target gene indicate popularity.) FGFR3

* Data provided by citexs.com, for reference only.

Publishing research using A0404? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order