Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FGF2 Rabbit pAb (A0235)

Publications (13) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - FGF2 Rabbit pAb (A0235)

Western blot analysis of extracts of 293T cells, using FGF2 antibody (A0235) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Western blot - FGF2 Rabbit pAb (A0235)

Western blot analysis of extracts of various cell lines, using FGF2 antibody (A0235) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - FGF2 Rabbit pAb (A0235)

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - FGF2 Rabbit pAb (A0235)

Immunohistochemistry analysis of paraffin-embedded Rat ovary using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - FGF2 Rabbit pAb (A0235)

Immunohistochemistry analysis of paraffin-embedded Human colon using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - FGF2 Rabbit pAb (A0235)

Immunofluorescence analysis of C6 cells using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - FGF2 Rabbit pAb (A0235)

Immunofluorescence analysis of L929 cells using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - FGF2 Rabbit pAb (A0235)

Immunofluorescence analysis of U-2 OS cells using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name FGF2 Rabbit pAb
Catalog No. A0235
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 143-288 of human FGF2 (NP_001997.5).
Sequence PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Gene ID 2247
Swiss prot P09038
Synonyms BFGF; FGFB; FGF-2; HBGF-2; FGF2
Calculated MW 31kDa
Observed MW 26kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T
Cellular location Nucleus, Secreted
Customer validation

WB (Gallus gallus, Oryctolagus cuniculus, Rattus norvegicus, Xenopus laevis, Mus musculus, Homo sapiensMus musculus)

IB (Homo sapiens)

IF (Homo sapiens, Mus musculus, Homo sapiensMus musculus)

IHC (Rattus norvegicus, Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FGF2 Rabbit pAb images

ABclonal:Western blot - FGF2 Rabbit pAb (A0235)}

Western blot - FGF2 Rabbit pAb (A0235)

Western blot analysis of extracts of 293T cells, using FGF2 antibody (A0235) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Western blot - FGF2 Rabbit pAb (A0235)}

Western blot - FGF2 Rabbit pAb (A0235)

Western blot analysis of extracts of various cell lines, using FGF2 antibody (A0235) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - FGF2 Rabbit pAb (A0235)}

Immunohistochemistry - FGF2 Rabbit pAb (A0235)

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - FGF2 Rabbit pAb (A0235)}

Immunohistochemistry - FGF2 Rabbit pAb (A0235)

Immunohistochemistry analysis of paraffin-embedded Rat ovary using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - FGF2 Rabbit pAb (A0235)}

Immunohistochemistry - FGF2 Rabbit pAb (A0235)

Immunohistochemistry analysis of paraffin-embedded Human colon using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - FGF2 Rabbit pAb (A0235)}

Immunofluorescence - FGF2 Rabbit pAb (A0235)

Immunofluorescence analysis of C6 cells using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - FGF2 Rabbit pAb (A0235)}

Immunofluorescence - FGF2 Rabbit pAb (A0235)

Immunofluorescence analysis of L929 cells using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - FGF2 Rabbit pAb (A0235)}

Immunofluorescence - FGF2 Rabbit pAb (A0235)

Immunofluorescence analysis of U-2 OS cells using FGF2 Rabbit pAb (A0235) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0235 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FGF2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FGF2. (Distance between topics and target gene indicate popularity.) FGF2

* Data provided by citexs.com, for reference only.

Publishing research using A0235? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order