Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FGF1 Rabbit pAb (A0079)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunofluorescence - FGF1 Rabbit pAb (A0079)

Immunofluorescence analysis of HepG2 cells using FGF1 Rabbit pAb (A0079) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - FGF1 Rabbit pAb (A0079)

Immunofluorescence analysis of NIH/3T3 cells using FGF1 Rabbit pAb (A0079) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - FGF1 Rabbit pAb (A0079)

Immunofluorescence analysis of PC-12 cells using FGF1 Rabbit pAb (A0079) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name FGF1 Rabbit pAb
Catalog No. A0079
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2-155 of human FGF1 (NP_000791.1).
Sequence AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Gene ID 2246
Swiss prot P05230
Synonyms AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha; FGF1
Calculated MW 17kDa
Observed MW Refer to Figures

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Immunofluorescence    
Positive samples
Cellular location Cytoplasm, Nucleus, Secreted, cell cortex, cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FGF1 Rabbit pAb images

ABclonal:Immunofluorescence - FGF1 Rabbit pAb (A0079)}

Immunofluorescence - FGF1 Rabbit pAb (A0079)

Immunofluorescence analysis of HepG2 cells using FGF1 Rabbit pAb (A0079) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - FGF1 Rabbit pAb (A0079)}

Immunofluorescence - FGF1 Rabbit pAb (A0079)

Immunofluorescence analysis of NIH/3T3 cells using FGF1 Rabbit pAb (A0079) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - FGF1 Rabbit pAb (A0079)}

Immunofluorescence - FGF1 Rabbit pAb (A0079)

Immunofluorescence analysis of PC-12 cells using FGF1 Rabbit pAb (A0079) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0079 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FGF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FGF1. (Distance between topics and target gene indicate popularity.) FGF1

* Data provided by citexs.com, for reference only.

Publishing research using A0079? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order