Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FGF12 Rabbit pAb (A2667)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - FGF12 Rabbit pAb (A2667)

Western blot analysis of extracts of various cell lines, using FGF12 antibody (A2667) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

ABclonal:Immunohistochemistry - FGF12 Rabbit pAb (A2667)

Immunohistochemistry analysis of paraffin-embedded rat testis using FGF12 antibody (A2667) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - FGF12 Rabbit pAb (A2667)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using FGF12 antibody (A2667) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - FGF12 Rabbit pAb (A2667)

Immunohistochemistry analysis of paraffin-embedded mouse testis using FGF12 antibody (A2667) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name FGF12 Rabbit pAb
Catalog No. A2667
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human FGF12 (NP_004104.3).
Sequence MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Gene ID 2257
Swiss prot P61328
Synonyms FHF1; DEE47; EIEE47; FGF12B; FGF12
Calculated MW 27kDa
Observed MW 20kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse brain, Rat brain
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

FGF12 Rabbit pAb images

ABclonal:Western blot - FGF12 Rabbit pAb (A2667)}

Western blot - FGF12 Rabbit pAb (A2667)

Western blot analysis of extracts of various cell lines, using FGF12 antibody (A2667) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.
ABclonal:Immunohistochemistry - FGF12 Rabbit pAb (A2667)}

Immunohistochemistry - FGF12 Rabbit pAb (A2667)

Immunohistochemistry analysis of paraffin-embedded rat testis using FGF12 antibody (A2667) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - FGF12 Rabbit pAb (A2667)}

Immunohistochemistry - FGF12 Rabbit pAb (A2667)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using FGF12 antibody (A2667) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - FGF12 Rabbit pAb (A2667)}

Immunohistochemistry - FGF12 Rabbit pAb (A2667)

Immunohistochemistry analysis of paraffin-embedded mouse testis using FGF12 antibody (A2667) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A2667 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FGF12. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FGF12. (Distance between topics and target gene indicate popularity.) FGF12

* Data provided by citexs.com, for reference only.

Publishing research using A2667? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order