Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Fibrinogen alpha chain (FGA) Rabbit pAb (A1453)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Fibrinogen alpha chain (FGA) Rabbit pAb (A1453)

Western blot analysis of various lysates using Fibrinogen alpha chain (FGA) Rabbit pAb (A1453) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Fibrinogen alpha chain (FGA) Rabbit pAb (A1453)

Immunohistochemistry analysis of Fibrinogen alpha chain (FGA) in paraffin-embedded human placenta using Fibrinogen alpha chain (Fibrinogen alpha chain (FGA)) Rabbit pAb (A1453) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name Fibrinogen alpha chain (FGA) Rabbit pAb
Catalog No. A1453
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the alpha subunit of the coagulation factor fibrinogen, which is a component of the blood clot. Following vascular injury, the encoded preproprotein is proteolytically processed by thrombin during the conversion of fibrinogen to fibrin. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 410-559 of human Fibrinogen alpha chain (FGA) (NP_000499.1).
Sequence WGTFEEVSGNVSPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEFVSETESRGSESGIFTNTKE
Gene ID 2243
Swiss prot P02671
Synonyms Fib2; Fibrinogen alpha chain (FGA)
Calculated MW 95kDa
Observed MW 95kDa/60-70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HepG2, Mouse liver, Rat liver
Cellular location Secreted
Customer validation

ELISA (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Fibrinogen alpha chain (FGA) Rabbit pAb images

ABclonal:Western blot - Fibrinogen alpha chain (FGA) Rabbit pAb (A1453)}

Western blot - Fibrinogen alpha chain (FGA) Rabbit pAb (A1453)

Western blot analysis of various lysates using Fibrinogen alpha chain (FGA) Rabbit pAb (A1453) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - Fibrinogen alpha chain (FGA) Rabbit pAb (A1453)}

Immunohistochemistry - Fibrinogen alpha chain (FGA) Rabbit pAb (A1453)

Immunohistochemistry analysis of Fibrinogen alpha chain (FGA) in paraffin-embedded human placenta using Fibrinogen alpha chain (Fibrinogen alpha chain (FGA)) Rabbit pAb (A1453) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1453 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FGA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FGA. (Distance between topics and target gene indicate popularity.) FGA

* Data provided by citexs.com, for reference only.

Publishing research using A1453? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order