Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FEM1A Rabbit pAb (A16129)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - FEM1A Rabbit pAb (A16129)

Western blot analysis of various lysates using FEM1A Rabbit pAb (A16129) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name FEM1A Rabbit pAb
Catalog No. A16129
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables EP4 subtype prostaglandin E2 receptor binding activity and ubiquitin ligase-substrate adaptor activity. Involved in negative regulation of inflammatory response and ubiquitin-dependent protein catabolic process via the C-end degron rule pathway. Part of Cul2-RING ubiquitin ligase complex. Is active in mitochondrion.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-300 of human FEM1A (NP_061178.1).
Sequence RSLLRRGASVNRTTRTNSTPLRAACFDGHLEVVRYLVGEHQADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCKARMERDGYGMTPLLAASVTGHTNIVEYLIQEQPGQEQVAGGEAQPGLPQEDPSTSQGCAQPQGAPCCSSSPEEPLNGESYESCCPTSREAAVEA
Gene ID 55527
Swiss prot Q9BSK4
Synonyms EPRAP; FEM1A
Calculated MW 74kDa
Observed MW 80kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, K-562, Mouse kidney
Cellular location Cytoplasm

Research Area

FEM1A Rabbit pAb images

ABclonal:Western blot - FEM1A Rabbit pAb (A16129)}

Western blot - FEM1A Rabbit pAb (A16129)

Western blot analysis of various lysates using FEM1A Rabbit pAb (A16129) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A16129 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FEM1A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FEM1A. (Distance between topics and target gene indicate popularity.) FEM1A

* Data provided by citexs.com, for reference only.

Publishing research using A16129? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order