Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FCN2 Rabbit pAb (A16690)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - FCN2 Rabbit pAb (A16690)

Western blot analysis of various lysates using FCN2 Rabbit pAb (A16690) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name FCN2 Rabbit pAb
Catalog No. A16690
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-290 of human FCN2 (NP_004099.2).
Sequence SAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANG
Gene ID 2220
Swiss prot Q15485
Synonyms P35; FCNL; EBP-37; ficolin-2; FCN2
Calculated MW 34kDa
Observed MW 34kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples mosue spleen, mouse lung, rat spleen
Cellular location blood microparticle, external side of plasma membrane, extracellular exosome, extracellular region, extracellular space

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FCN2 Rabbit pAb images

ABclonal:Western blot - FCN2 Rabbit pAb (A16690)}

Western blot - FCN2 Rabbit pAb (A16690)

Western blot analysis of various lysates using FCN2 Rabbit pAb (A16690) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A16690 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FCN2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FCN2. (Distance between topics and target gene indicate popularity.) FCN2

* Data provided by citexs.com, for reference only.

Publishing research using A16690? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order