Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Fibrillarin/U3 RNP Rabbit pAb (A1136)

Reviews (3) Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Monkey

ABclonal:Western blot - Fibrillarin/U3 RNP Rabbit pAb (A1136)

Western blot analysis of various lysates using Fibrillarin/U3 RNP Rabbit pAb (A1136) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - Fibrillarin/U3 RNP Rabbit pAb (A1136)

Immunofluorescence analysis of HeLa cells using Fibrillarin/U3 RNP Rabbit pAb (A1136) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Fibrillarin/U3 RNP Rabbit pAb (A1136)

Confocal immunofluorescence analysis of U-2OS cells using Fibrillarin/U3 RNP Rabbit pAb (A1136) at dilution of 1:200. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Fibrillarin/U3 RNP Rabbit pAb (A1136)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 1 μg Fibrillarin/U3 RNP antibody (A1136). Western blot was performed from the immunoprecipitate using Fibrillarin/U3 RNP antibody (A1136) at a dilution of 1:1000.

Review
ABclonal: review for Fibrillarin/U3 RNP Rabbit pAb(A1136)
Review
ABclonal: review for Fibrillarin/U3 RNP Rabbit pAb(A1136)
Review
ABclonal: review for Fibrillarin/U3 RNP Rabbit pAb(A1136)

You may also interested in:

Overview

Product name Fibrillarin/U3 RNP Rabbit pAb
Catalog No. A1136
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-321 of human Fibrillarin/U3 RNP (NP_001427.2).
Sequence RGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN
Gene ID 2091
Swiss prot P22087
Synonyms FIB; FLRN; Nop1; RNU3IP1; Fibrillarin/U3 RNP
Calculated MW 34kDa
Observed MW 36kDa

Applications

Reactivity Human, Mouse, Rat, Monkey
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, A-375, U2OS, COS1, COS7, PC-12, Mouse brain, Mouse testis
Cellular location Nucleus, nucleolus
Customer validation

IF (Mouse ESCHomo sapiens)

IP (Mouse ESC)

WB (HepG2Homo sapiens, Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Fibrillarin/U3 RNP Rabbit pAb images

ABclonal:Western blot - Fibrillarin/U3 RNP Rabbit pAb (A1136)}

Western blot - Fibrillarin/U3 RNP Rabbit pAb (A1136)

Western blot analysis of various lysates using Fibrillarin/U3 RNP Rabbit pAb (A1136) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunofluorescence - Fibrillarin/U3 RNP Rabbit pAb (A1136)}

Immunofluorescence - Fibrillarin/U3 RNP Rabbit pAb (A1136)

Immunofluorescence analysis of HeLa cells using Fibrillarin/U3 RNP Rabbit pAb (A1136) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Fibrillarin/U3 RNP Rabbit pAb (A1136)}

Immunofluorescence - Fibrillarin/U3 RNP Rabbit pAb (A1136)

Confocal immunofluorescence analysis of U-2OS cells using Fibrillarin/U3 RNP Rabbit pAb (A1136) at dilution of 1:200. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - Fibrillarin/U3 RNP Rabbit pAb (A1136)}

Immunoprecipitation - Fibrillarin/U3 RNP Rabbit pAb (A1136)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 1 μg Fibrillarin/U3 RNP antibody (A1136). Western blot was performed from the immunoprecipitate using Fibrillarin/U3 RNP antibody (A1136) at a dilution of 1:1000.

Submit an review for A1136

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1136 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FBL. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FBL. (Distance between topics and target gene indicate popularity.) FBL

* Data provided by citexs.com, for reference only.

Publishing research using A1136? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order