Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FAM3B Rabbit pAb (A13592)

Publication (1) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - FAM3B Rabbit pAb (A13592)

Western blot analysis of extracts of various cell lines, using FAM3B antibody (A13592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

You may also interested in:

Overview

Product name FAM3B Rabbit pAb
Catalog No. A13592
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Involved in insulin secretion. Located in extracellular exosome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-235 of human FAM3B (NP_478066.3).
Sequence ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Gene ID 54097
Swiss prot P58499
Synonyms 2-21; ORF9; PANDER; PRED44; C21orf11; C21orf76; FAM3B
Calculated MW 26kDa
Observed MW 28kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, Mouse intestine
Cellular location Secreted
Customer validation

WB (Mus musculus)

Research Area

FAM3B Rabbit pAb images

ABclonal:Western blot - FAM3B Rabbit pAb (A13592)}

Western blot - FAM3B Rabbit pAb (A13592)

Western blot analysis of extracts of various cell lines, using FAM3B antibody (A13592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Inquire About This Product

Submit your question about A13592 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FAM3B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FAM3B. (Distance between topics and target gene indicate popularity.) FAM3B

* Data provided by citexs.com, for reference only.

Publishing research using A13592? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order