Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FA2H Rabbit pAb (A13873)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - FA2H Rabbit pAb (A13873)

Western blot analysis of various lysates using FA2H Rabbit pAb (A13873) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.

You may also interested in:

Overview

Product name FA2H Rabbit pAb
Catalog No. A13873
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that catalyzes the synthesis of 2-hydroxysphingolipids, a subset of sphingolipids that contain 2-hydroxy fatty acids. Sphingolipids play roles in many cellular processes and their structural diversity arises from modification of the hydrophobic ceramide moiety, such as by 2-hydroxylation of the N-acyl chain, and the existence of many different head groups. Mutations in this gene have been associated with leukodystrophy dysmyelinating with spastic paraparesis with or without dystonia.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 95-170 of human FA2H (NP_077282.3).
Sequence NEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWY
Gene ID 79152
Swiss prot Q7L5A8
Synonyms FAAH; FAH1; SCS7; SPG35; FAXDC1; FA2H
Calculated MW 43kDa
Observed MW 38kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG, HT-29, SGC-7901, BxPC-3, 293T
Cellular location Endoplasmic reticulum membrane, Microsome membrane, Multi-pass membrane protein

Research Area

FA2H Rabbit pAb images

ABclonal:Western blot - FA2H Rabbit pAb (A13873)}

Western blot - FA2H Rabbit pAb (A13873)

Western blot analysis of various lysates using FA2H Rabbit pAb (A13873) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.

Inquire About This Product

Submit your question about A13873 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FA2H. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FA2H. (Distance between topics and target gene indicate popularity.) FA2H

* Data provided by citexs.com, for reference only.

Publishing research using A13873? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order