Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Estrogen Receptor beta Rabbit pAb (A2546)

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Estrogen Receptor beta Rabbit pAb (A2546)

Western blot analysis of lysates from Daudi cells using Estrogen Receptor beta Rabbit pAb(A2546) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name Estrogen Receptor beta Rabbit pAb
Catalog No. A2546
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human Estrogen Receptor beta (NP_001428.1).
Sequence MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCS
Gene ID 2100
Swiss prot Q92731
Synonyms Erb; ESRB; ODG8; ESTRB; NR3A2; ER-BETA; ESR-BETA; Estrogen Receptor beta
Calculated MW 59kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Daudi
Cellular location Nucleus
Customer validation

WB (Mus musculus, Gallus gallus, Homo sapiens)

IF (Danio rerio)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Estrogen Receptor beta Rabbit pAb images

ABclonal:Western blot - Estrogen Receptor beta Rabbit pAb (A2546)}

Western blot - Estrogen Receptor beta Rabbit pAb (A2546)

Western blot analysis of lysates from Daudi cells using Estrogen Receptor beta Rabbit pAb(A2546) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A2546 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ESR2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ESR2. (Distance between topics and target gene indicate popularity.) ESR2

* Data provided by citexs.com, for reference only.

Publishing research using A2546? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order