Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

EVC Rabbit pAb (A12634)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

You may also interested in:

Overview

Product name EVC Rabbit pAb
Catalog No. A12634
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein containing a leucine zipper and a transmembrane domain. This gene has been implicated in both Ellis-van Creveld syndrome (EvC) and Weyers acrodental dysostosis.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 743-992 of human EVC (NP_714928.1).
Sequence AIGQALLVHARNAATKSRAKDRDDFKRTLMEAAVESVYVTSAGVSRLVQAYYQQIGRIMEDHEERKLQHLKTLQGERMENYKLRKKQELSNPSSGSRTAGGAHETSQAVHQRMLSQQKRFLAQFPVHQQMRLHAQQQQAGVMDLLEAQLETQLQEAEQNFISELAALARVPLAESKLLPAKRGLLEKPLRTKRKKPLPQERGDLGVPNNEDLASGDQTSGSLSSKRLSQQESEAGDSGNSKKMLKRRSNL
Gene ID 2121
Swiss prot P57679
Synonyms EVC1; EVCL; DWF-1; EVC
Calculated MW 112kDa
Observed MW Refer to Figures

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples
Cellular location Cell membrane, Cell projection, Cytoplasm, Single-pass membrane protein, cilium, cilium basal body, cilium membrane, cytoskeleton

Research Area

Inquire About This Product

Submit your question about A12634 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EVC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EVC. (Distance between topics and target gene indicate popularity.) EVC

* Data provided by citexs.com, for reference only.

Publishing research using A12634? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order