Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ETV1 Rabbit pAb (A13303)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunohistochemistry - ETV1 Rabbit pAb (A13303)

Immunohistochemistry analysis of paraffin-embedded rat pancreas using ETV1 antibody (A13303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ETV1 Rabbit pAb (A13303)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using ETV1 antibody (A13303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ETV1 Rabbit pAb (A13303)

Immunohistochemistry analysis of paraffin-embedded mouse pancreas using ETV1 antibody (A13303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ETV1 Rabbit pAb (A13303)

Immunofluorescence analysis of A549 cells using ETV1 antibody (A13303).

You may also interested in:

Overview

Product name ETV1 Rabbit pAb
Catalog No. A13303
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. All ETS proteins contain an ETS DNA-binding domain that binds to DNA sequences containing the consensus 5'-CGGA[AT]-3'. The protein encoded by this gene contains a conserved short acidic transactivation domain (TAD) in the N-terminal region, in addition to the ETS DNA-binding domain in the C-terminal region. This gene is involved in chromosomal translocations, which result in multiple fusion proteins including EWS-ETV1 in Ewing sarcoma and at least 10 ETV1 partners (see PMID: 19657377, Table 1) in prostate cancer. In addition to chromosomal rearrangement, this gene is overexpressed in prostate cancer, melanoma and gastrointestinal stromal tumor. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-300 of human ETV1 (NP_004947.2).
Sequence AFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQ
Gene ID 2115
Swiss prot P50549
Synonyms ER81; ETV1
Calculated MW 55kDa
Observed MW

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Immunohistochemistry    Immunofluorescence    
Positive samples
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ETV1 Rabbit pAb images

ABclonal:Immunohistochemistry - ETV1 Rabbit pAb (A13303)}

Immunohistochemistry - ETV1 Rabbit pAb (A13303)

Immunohistochemistry analysis of paraffin-embedded rat pancreas using ETV1 antibody (A13303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ETV1 Rabbit pAb (A13303)}

Immunohistochemistry - ETV1 Rabbit pAb (A13303)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using ETV1 antibody (A13303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ETV1 Rabbit pAb (A13303)}

Immunohistochemistry - ETV1 Rabbit pAb (A13303)

Immunohistochemistry analysis of paraffin-embedded mouse pancreas using ETV1 antibody (A13303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - ETV1 Rabbit pAb (A13303)}

Immunofluorescence - ETV1 Rabbit pAb (A13303)

Immunofluorescence analysis of A549 cells using ETV1 antibody (A13303).

Inquire About This Product

Submit your question about A13303 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ETV1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ETV1. (Distance between topics and target gene indicate popularity.) ETV1

* Data provided by citexs.com, for reference only.

Publishing research using A13303? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order