Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ESAM Rabbit pAb (A12210)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - ESAM Rabbit pAb (A12210)

Western blot analysis of various lysates using ESAM Rabbit pAb (A12210) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

You may also interested in:

Overview

Product name ESAM Rabbit pAb
Catalog No. A12210
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables cell-cell adhesion mediator activity. Involved in several processes, including bicellular tight junction assembly; cell-cell adhesion; and regulation of actin cytoskeleton organization. Located in cell-cell junction and plasma membrane. Part of protein-containing complex.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-248 of human ESAM (NP_620411.2).
Sequence QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAA
Gene ID 90952
Swiss prot Q96AP7
Synonyms W117m; ESAM
Calculated MW 41kDa
Observed MW 60kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HT-29, HepG2, 293T, A-549
Cellular location Cell junction, Cell membrane, Single-pass type I membrane protein, adherens junction, tight junction

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ESAM Rabbit pAb images

ABclonal:Western blot - ESAM Rabbit pAb (A12210)}

Western blot - ESAM Rabbit pAb (A12210)

Western blot analysis of various lysates using ESAM Rabbit pAb (A12210) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Inquire About This Product

Submit your question about A12210 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ESAM. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ESAM. (Distance between topics and target gene indicate popularity.) ESAM

* Data provided by citexs.com, for reference only.

Publishing research using A12210? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order