Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ErbB4/HER4 Rabbit pAb (A0749)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Rat

ABclonal:Western blot - ErbB4/HER4 Rabbit pAb (A0749)

Western blot analysis of extracts of rat brain, using ErbB4/HER4 antibody (A0749) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name ErbB4/HER4 Rabbit pAb
Catalog No. A0749
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the Tyr protein kinase family and the epidermal growth factor receptor subfamily. It encodes a single-pass type I membrane protein with multiple cysteine rich domains, a transmembrane domain, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domain binding motif. The protein binds to and is activated by neuregulins and other factors and induces a variety of cellular responses including mitogenesis and differentiation. Multiple proteolytic events allow for the release of a cytoplasmic fragment and an extracellular fragment. Mutations in this gene have been associated with cancer. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1150-1250 of human ErbB4/HER4 (NP_005226.1).
Sequence YMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPR
Gene ID 2066
Swiss prot Q15303
Synonyms HER4; ALS19; p180erbB4; ErbB4/HER4
Calculated MW 147kDa
Observed MW 147kDa

Applications

Reactivity Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Rat brain
Cellular location Cell membrane, Mitochondrion, Nucleus, Single-pass type I membrane protein
Customer validation

WB (Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ErbB4/HER4 Rabbit pAb images

ABclonal:Western blot - ErbB4/HER4 Rabbit pAb (A0749)}

Western blot - ErbB4/HER4 Rabbit pAb (A0749)

Western blot analysis of extracts of rat brain, using ErbB4/HER4 antibody (A0749) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A0749 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ERBB4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ERBB4. (Distance between topics and target gene indicate popularity.) ERBB4

* Data provided by citexs.com, for reference only.

Publishing research using A0749? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order