Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ENTPD5 Rabbit pAb (A8108)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Immunofluorescence - ENTPD5 Rabbit pAb (A8108)

Immunofluorescence analysis of U2OS cells using ENTPD5 antibody (A8108) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ENTPD5 Rabbit pAb
Catalog No. A8108
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 149-428 of human ENTPD5 (NP_001240.1).
Sequence KEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH
Gene ID 957
Swiss prot O75356
Synonyms PCPH; CD39L4; NTPDase-5; ENTPD5
Calculated MW 48kDa
Observed MW

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Immunofluorescence    
Positive samples
Cellular location Endoplasmic reticulum, Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ENTPD5 Rabbit pAb images

ABclonal:Immunofluorescence - ENTPD5 Rabbit pAb (A8108)}

Immunofluorescence - ENTPD5 Rabbit pAb (A8108)

Immunofluorescence analysis of U2OS cells using ENTPD5 antibody (A8108) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A8108 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ENTPD5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ENTPD5. (Distance between topics and target gene indicate popularity.) ENTPD5

* Data provided by citexs.com, for reference only.

Publishing research using A8108? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order