Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

eIF5A Rabbit pAb (A2016)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - eIF5A Rabbit pAb (A2016)

Western blot analysis of extracts of various cell lines, using eIF5A antibody (A2016) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunohistochemistry - eIF5A Rabbit pAb (A2016)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using eIF5A Rabbit pAb (A2016) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - eIF5A Rabbit pAb (A2016)

Immunofluorescence analysis of U2OS cells using eIF5A antibody (A2016). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name eIF5A Rabbit pAb
Catalog No. A2016
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables U6 snRNA binding activity and protein N-terminus binding activity. Involved in several processes, including cellular response to virus; positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator; and tumor necrosis factor-mediated signaling pathway. Located in annulate lamellae; cytoplasm; and nucleus. Part of nuclear pore.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human eIF5A (NP_001137234.1).
Sequence MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Gene ID 1984
Swiss prot P63241
Synonyms FABAS; EIF-5A; EIF5A1; eIF-4D; eIF5AI; eIF5A
Calculated MW 17kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, 293T, Raji, 22Rv1, HepG2, K-562, U-251MG, Mouse liver, Mouse testis
Cellular location Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Nucleus, Peripheral membrane protein, nuclear pore complex
Customer validation

WB (Microplitis bicoloratus bracovirus, Homo sapiens, Trichoplusia ni)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

eIF5A Rabbit pAb images

ABclonal:Western blot - eIF5A Rabbit pAb (A2016)}

Western blot - eIF5A Rabbit pAb (A2016)

Western blot analysis of extracts of various cell lines, using eIF5A antibody (A2016) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunohistochemistry - eIF5A Rabbit pAb (A2016)}

Immunohistochemistry - eIF5A Rabbit pAb (A2016)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using eIF5A Rabbit pAb (A2016) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - eIF5A Rabbit pAb (A2016)}

Immunofluorescence - eIF5A Rabbit pAb (A2016)

Immunofluorescence analysis of U2OS cells using eIF5A antibody (A2016). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A2016 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EIF5A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EIF5A. (Distance between topics and target gene indicate popularity.) EIF5A

* Data provided by citexs.com, for reference only.

Publishing research using A2016? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order