Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

EGLN1/EGLN2 Rabbit pAb (A10342)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - EGLN1/EGLN2 Rabbit pAb (A10342)

Western blot analysis of extracts of various cell lines, using EGLN1/EGLN2 antibody (A10342) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name EGLN1/EGLN2 Rabbit pAb
Catalog No. A10342
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The proteins encoded by EGLN1/EGLN2 gene catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. HIF is a transcriptional complex that plays a central role in mammalian oxygen homeostasis. This protein functions as a cellular oxygen sensor, and under normal oxygen concentration, modification by prolyl hydroxylation is a key regulatory event that targets HIF subunits for proteasomal destruction via the von Hippel-Lindau ubiquitylation complex.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human EGLN1/EGLN2 (NP_071334.1/NP_444274.1).
Sequence DIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGK
Gene ID 54583112398
Swiss prot Q9GZT9Q96KS0
Synonyms EGLN1/EGLN2
Calculated MW 36kDa/43kDa/46kDa/40kDa
Observed MW 44kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HL-60, 293T
Cellular location cytoplasm, cytosol, glutamatergic synapse, nucleus, postsynaptic density

EGLN1/EGLN2 Rabbit pAb images

ABclonal:Western blot - EGLN1/EGLN2 Rabbit pAb (A10342)}

Western blot - EGLN1/EGLN2 Rabbit pAb (A10342)

Western blot analysis of extracts of various cell lines, using EGLN1/EGLN2 antibody (A10342) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A10342 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EGLN1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EGLN1. (Distance between topics and target gene indicate popularity.) EGLN1

* Data provided by citexs.com, for reference only.

Publishing research using A10342? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order