Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KD Validated] EGFR Rabbit pAb (A11577)

Publications (10) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - [KD Validated] EGFR Rabbit pAb (A11577)

Western blot analysis of lysates from wild type(WT) and EGFR Rabbit pAb knockdown (KD) HeLa cells, using [KD Validated] EGFR Rabbit pAb (A11577) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.

ABclonal:Immunohistochemistry - [KD Validated] EGFR Rabbit pAb (A11577)

Immunohistochemistry analysis of EGFR in paraffin-embedded human lung cancer using [KD Validated] EGFR Rabbit pAb (A11577) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KD Validated] EGFR Rabbit pAb (A11577)

Immunohistochemistry analysis of EGFR in paraffin-embedded human placenta using [KD Validated] EGFR Rabbit pAb (A11577) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KD Validated] EGFR Rabbit pAb (A11577)

Immunofluorescence analysis of A-431 cells using [KD Validated] EGFR Rabbit pAb (A11577) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KD Validated] EGFR Rabbit pAb
Catalog No. A11577
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1021-1210 of human EGFR (NP_005219.2).
Sequence QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
Gene ID 1956
Swiss prot P00533
Synonyms ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2; FR
Calculated MW 134kDa
Observed MW 175kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa
Cellular location Cell membrane, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus membrane, Nucleus membrane, Nucleus, Secreted, Single-pass type I membrane protein
Customer validation

WB (Homo sapiens, Rattus norvegicus, Mus musculus)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] EGFR Rabbit pAb images

ABclonal:Western blot - [KD Validated] EGFR Rabbit pAb (A11577)}

Western blot - [KD Validated] EGFR Rabbit pAb (A11577)

Western blot analysis of lysates from wild type(WT) and EGFR Rabbit pAb knockdown (KD) HeLa cells, using [KD Validated] EGFR Rabbit pAb (A11577) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.
ABclonal:Immunohistochemistry - [KD Validated] EGFR Rabbit pAb (A11577)}

Immunohistochemistry - [KD Validated] EGFR Rabbit pAb (A11577)

Immunohistochemistry analysis of EGFR in paraffin-embedded human lung cancer using [KD Validated] EGFR Rabbit pAb (A11577) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KD Validated] EGFR Rabbit pAb (A11577)}

Immunohistochemistry - [KD Validated] EGFR Rabbit pAb (A11577)

Immunohistochemistry analysis of EGFR in paraffin-embedded human placenta using [KD Validated] EGFR Rabbit pAb (A11577) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KD Validated] EGFR Rabbit pAb (A11577)}

Immunofluorescence - [KD Validated] EGFR Rabbit pAb (A11577)

Immunofluorescence analysis of A-431 cells using [KD Validated] EGFR Rabbit pAb (A11577) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11577 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EGFR. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EGFR. (Distance between topics and target gene indicate popularity.) EGFR

* Data provided by citexs.com, for reference only.

Publishing research using A11577? Please let us know so that we can cite the reference in this datasheet.

Antibodies (36)

ELISA Kits (1)

Proteins (5)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order