Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

E-Cadherin Rabbit pAb (A11509)

Publications (15) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - E-Cadherin Rabbit pAb (A11509)

Western blot analysis of extracts of various cell lines, using E-Cadherin antibody (A11509) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

You may also interested in:

Overview

Product name E-Cadherin Rabbit pAb
Catalog No. A11509
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function of this gene is thought to contribute to cancer progression by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. This gene is present in a gene cluster with other members of the cadherin family on chromosome 16.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human E-Cadherin (NP_004351.1).
Sequence PVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPR
Gene ID 999
Swiss prot P12830
Synonyms UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324; E-Cadherin
Calculated MW 97kDa
Observed MW 130kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse liver, Mouse kidney
Cellular location Cell junction, Cell membrane, Endosome, Golgi apparatus, Single-pass type I membrane protein, trans-Golgi network
Customer validation

WB (Homo sapiens)

IF (Homo sapiens)

IHC (Homo sapiens, Oreochromis niloticus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

E-Cadherin Rabbit pAb images

ABclonal:Western blot - E-Cadherin Rabbit pAb (A11509)}

Western blot - E-Cadherin Rabbit pAb (A11509)

Western blot analysis of extracts of various cell lines, using E-Cadherin antibody (A11509) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Inquire About This Product

Submit your question about A11509 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDH1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDH1. (Distance between topics and target gene indicate popularity.) CDH1

* Data provided by citexs.com, for reference only.

Publishing research using A11509? Please let us know so that we can cite the reference in this datasheet.

Antibodies (13)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order