Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

E2F8 Rabbit pAb (A1135)

Publications (6) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - E2F8 Rabbit pAb (A1135)

Western blot analysis of various lysates using E2F8 Rabbit pAb (A1135) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).

You may also interested in:

Overview

Product name E2F8 Rabbit pAb
Catalog No. A1135
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of a family of transcription factors which regulate the expression of genes required for progression through the cell cycle. The encoded protein regulates progression from G1 to S phase by ensuring the nucleus divides at the proper time. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 788-867 of human E2F8 (NP_078956.2).
Sequence PVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDVH
Gene ID 79733
Swiss prot A0AVK6
Synonyms E2F-8; E2F8
Calculated MW 94kDa
Observed MW 105kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SW480, Mouse testis
Cellular location Nucleus
Customer validation

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

E2F8 Rabbit pAb images

ABclonal:Western blot - E2F8 Rabbit pAb (A1135)}

Western blot - E2F8 Rabbit pAb (A1135)

Western blot analysis of various lysates using E2F8 Rabbit pAb (A1135) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).

Inquire About This Product

Submit your question about A1135 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on E2F8. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to E2F8. (Distance between topics and target gene indicate popularity.) E2F8

* Data provided by citexs.com, for reference only.

Publishing research using A1135? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order