Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

DVL1 Rabbit pAb (A10536)

Reviews (2) Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - DVL1 Rabbit pAb (A10536)

Western blot analysis of various lysates, using DVL1 antibody (A10536) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - DVL1 Rabbit pAb (A10536)

Immunohistochemistry analysis of paraffin-embedded rat testis using DVL1 antibody (A10536) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - DVL1 Rabbit pAb (A10536)

Immunohistochemistry analysis of paraffin-embedded mouse testis using DVL1 antibody (A10536) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - DVL1 Rabbit pAb (A10536)

Immunofluorescence analysis of NIH-3T3 using DVL1 antibody (A10536) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - DVL1 Rabbit pAb (A10536)

Immunofluorescence analysis of C6 using DVL1 antibody (A10536) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for DVL1 Rabbit pAb(A10536)
Review
ABclonal: review for DVL1 Rabbit pAb(A10536)

You may also interested in:

Overview

Product name DVL1 Rabbit pAb
Catalog No. A10536
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 510-640 of human DVL1 (NP_004412.2).
Sequence GQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRE
Gene ID 1855
Swiss prot O14640
Synonyms DVL; DRS2; DVL1L1; DVL1P1; DVL1
Calculated MW 75kDa
Observed MW 75kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, PC-3, 293T
Cellular location Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Peripheral membrane protein, cytosol
Customer validation

WB (293TRattus norvegicus, Rattus norvegicus, Capra hircus)

IP (293T)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DVL1 Rabbit pAb images

ABclonal:Western blot - DVL1 Rabbit pAb (A10536)}

Western blot - DVL1 Rabbit pAb (A10536)

Western blot analysis of various lysates, using DVL1 antibody (A10536) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
ABclonal:Immunohistochemistry - DVL1 Rabbit pAb (A10536)}

Immunohistochemistry - DVL1 Rabbit pAb (A10536)

Immunohistochemistry analysis of paraffin-embedded rat testis using DVL1 antibody (A10536) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - DVL1 Rabbit pAb (A10536)}

Immunohistochemistry - DVL1 Rabbit pAb (A10536)

Immunohistochemistry analysis of paraffin-embedded mouse testis using DVL1 antibody (A10536) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - DVL1 Rabbit pAb (A10536)}

Immunofluorescence - DVL1 Rabbit pAb (A10536)

Immunofluorescence analysis of NIH-3T3 using DVL1 antibody (A10536) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - DVL1 Rabbit pAb (A10536)}

Immunofluorescence - DVL1 Rabbit pAb (A10536)

Immunofluorescence analysis of C6 using DVL1 antibody (A10536) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A10536

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A10536 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DVL1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DVL1. (Distance between topics and target gene indicate popularity.) DVL1

* Data provided by citexs.com, for reference only.

Publishing research using A10536? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order