Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Dot1L/KMT4 Rabbit pAb (A11285)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Rat, Mouse

ABclonal:Western blot - Dot1L/KMT4 Rabbit pAb (A11285)

Western blot analysis of lysates from Rat liver, using Dot1L/KMT4 Rabbit pAb (A11285) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

You may also interested in:

Overview

Product name Dot1L/KMT4 Rabbit pAb
Catalog No. A11285
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a histone methyltransferase that methylates lysine-79 of histone H3. It is inactive against free core histones, but shows significant histone methyltransferase activity against nucleosomes.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Dot1L/KMT4 (NP_115871.1).
Sequence MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVD
Gene ID 84444
Swiss prot Q8TEK3
Synonyms DOT1; KMT4; Dot1L/KMT4
Calculated MW 165kDa
Observed MW 185kDa

Applications

Reactivity Rat, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Rat liver
Cellular location Nucleus
Customer validation

WB (Gallus gallus, Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Dot1L/KMT4 Rabbit pAb images

ABclonal:Western blot - Dot1L/KMT4 Rabbit pAb (A11285)}

Western blot - Dot1L/KMT4 Rabbit pAb (A11285)

Western blot analysis of lysates from Rat liver, using Dot1L/KMT4 Rabbit pAb (A11285) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Inquire About This Product

Submit your question about A11285 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DOT1L. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DOT1L. (Distance between topics and target gene indicate popularity.) DOT1L

* Data provided by citexs.com, for reference only.

Publishing research using A11285? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order