Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] DNMT3A Rabbit mAb (A19659)

KO/KDValidated

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - [KO Validated] DNMT3A Rabbit mAb (A19659)

Western blot analysis of lysates from Mouse Thymus, using DNMT3A Rabbit mAb (A19659) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - [KO Validated] DNMT3A Rabbit mAb (A19659)

Western blot analysis of lysates from wild type (WT) and DNMT3A knockout (KO) 293T cells, using [KO Validated] DNMT3A (A19659) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - [KO Validated] DNMT3A Rabbit mAb (A19659)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg DNMT3A antibody (A19659). Western blot was performed from the immunoprecipitate using DNMT3A antibody (A19659) at a dilution of 1:1000.

You may also interested in:

Overview

Product name [KO Validated] DNMT3A Rabbit mAb
Catalog No. A19659
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0138

Background

CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 550-650 of human DNMT3A (Q9Y6K1).
Sequence GNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVL
Gene ID 1788
Swiss prot Q9Y6K1
Synonyms TBRS; HESJAS; DNMT3A2; M.HsaIIIA; 3A
Calculated MW 102kDa
Observed MW 85kDa/95kDa/130kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB HumanMouse
Recommended dilution
  • WB 1:100 - 1:500
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples 293T
Cellular location Cytoplasm, Nucleus
Customer validation

ChIP (Homo sapiens)

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] DNMT3A Rabbit mAb images

ABclonal:Western blot - [KO Validated] DNMT3A Rabbit mAb (A19659)}

Western blot - [KO Validated] DNMT3A Rabbit mAb (A19659)

Western blot analysis of lysates from Mouse Thymus, using DNMT3A Rabbit mAb (A19659) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - [KO Validated] DNMT3A Rabbit mAb (A19659)}

Western blot - [KO Validated] DNMT3A Rabbit mAb (A19659)

Western blot analysis of lysates from wild type (WT) and DNMT3A knockout (KO) 293T cells, using [KO Validated] DNMT3A (A19659) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunoprecipitation - [KO Validated] DNMT3A Rabbit mAb (A19659)}

Immunoprecipitation - [KO Validated] DNMT3A Rabbit mAb (A19659)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg DNMT3A antibody (A19659). Western blot was performed from the immunoprecipitate using DNMT3A antibody (A19659) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A19659 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DNMT3A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DNMT3A. (Distance between topics and target gene indicate popularity.) DNMT3A

* Data provided by citexs.com, for reference only.

Publishing research using A19659? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order