Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

DMT1/SLC11A2 Rabbit pAb (A10231)

Publications (10) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - DMT1/SLC11A2 Rabbit pAb (A10231)

Western blot analysis of extracts of various cell lines, using DMT1/SLC11A2 Rabbit pAb (A10231) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - DMT1/SLC11A2 Rabbit pAb (A10231)

Immunohistochemistry analysis of paraffin-embedded rat stomach using DMT1/SLC11A2 Rabbit pAb (A10231) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - DMT1/SLC11A2 Rabbit pAb (A10231)

Immunohistochemistry analysis of paraffin-embedded mouse stomach using DMT1/SLC11A2 Rabbit pAb (A10231) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name DMT1/SLC11A2 Rabbit pAb
Catalog No. A10231
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the solute carrier family 11 protein family. The product of this gene transports divalent metals and is involved in iron absorption. Mutations in this gene are associated with hypochromic microcytic anemia with iron overload. A related solute carrier family 11 protein gene is located on chromosome 2. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human DMT1/SLC11A2 (NP_001167597.1).
Sequence MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS
Gene ID 4891
Swiss prot P49281
Synonyms DCT1; DMT1; AHMIO1; NRAMP2; DMT1/SLC11A2
Calculated MW 62kDa
Observed MW 72kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples 293T, BxPC-3, SH-SY5Y, Rat testis, Rat kidney
Cellular location Cell membrane, Early endosome, Endosome membrane, Mitochondrion outer membrane, Multi-pass membrane protein
Customer validation

WB (Sus scrofa, Rattus norvegicus, Pelteobagrus fulvidraco, Mus musculus, Homo sapiens)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DMT1/SLC11A2 Rabbit pAb images

ABclonal:Western blot - DMT1/SLC11A2 Rabbit pAb (A10231)}

Western blot - DMT1/SLC11A2 Rabbit pAb (A10231)

Western blot analysis of extracts of various cell lines, using DMT1/SLC11A2 Rabbit pAb (A10231) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - DMT1/SLC11A2 Rabbit pAb (A10231)}

Immunohistochemistry - DMT1/SLC11A2 Rabbit pAb (A10231)

Immunohistochemistry analysis of paraffin-embedded rat stomach using DMT1/SLC11A2 Rabbit pAb (A10231) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - DMT1/SLC11A2 Rabbit pAb (A10231)}

Immunohistochemistry - DMT1/SLC11A2 Rabbit pAb (A10231)

Immunohistochemistry analysis of paraffin-embedded mouse stomach using DMT1/SLC11A2 Rabbit pAb (A10231) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A10231 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SLC11A2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SLC11A2. (Distance between topics and target gene indicate popularity.) SLC11A2

* Data provided by citexs.com, for reference only.

Publishing research using A10231? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order