Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

DEFB121 Rabbit pAb (A1208)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunohistochemistry - DEFB121 Rabbit pAb (A1208)

Immunohistochemistry analysis of paraffin-embedded human prostate using DEFB121 antibody (A1208) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - DEFB121 Rabbit pAb (A1208)

Immunofluorescence analysis of rat testis cells using DEFB121 antibody (A1208) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - DEFB121 Rabbit pAb (A1208)

Immunofluorescence analysis of mouse testis cells using DEFB121 antibody (A1208) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name DEFB121 Rabbit pAb
Catalog No. A1208
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-76 of human DEFB121 (NP_001011878.1).
Sequence MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV
Gene ID 245934
Swiss prot Q5J5C9
Synonyms DEFB21; ESC42RELC; DEFB121
Calculated MW 8kDa
Observed MW

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IHC-P 1:50 - 1:100
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Immunohistochemistry    Immunofluorescence    
Positive samples
Cellular location Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

DEFB121 Rabbit pAb images

ABclonal:Immunohistochemistry - DEFB121 Rabbit pAb (A1208)}

Immunohistochemistry - DEFB121 Rabbit pAb (A1208)

Immunohistochemistry analysis of paraffin-embedded human prostate using DEFB121 antibody (A1208) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - DEFB121 Rabbit pAb (A1208)}

Immunofluorescence - DEFB121 Rabbit pAb (A1208)

Immunofluorescence analysis of rat testis cells using DEFB121 antibody (A1208) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - DEFB121 Rabbit pAb (A1208)}

Immunofluorescence - DEFB121 Rabbit pAb (A1208)

Immunofluorescence analysis of mouse testis cells using DEFB121 antibody (A1208) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1208 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DEFB121. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DEFB121. (Distance between topics and target gene indicate popularity.) DEFB121

* Data provided by citexs.com, for reference only.

Publishing research using A1208? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order