Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

DDX21 Rabbit pAb (A7034)

Publications (4) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - DDX21 Rabbit pAb (A7034)

Western blot analysis of extracts of various cell lines, using DDX21 antibody (A7034) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 60s.

You may also interested in:

Overview

Product name DDX21 Rabbit pAb
Catalog No. A7034
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an antigen recognized by autoimmune antibodies from a patient with watermelon stomach disease. This protein unwinds double-stranded RNA, folds single-stranded RNA, and may play important roles in ribosomal RNA biogenesis, RNA editing, RNA transport, and general transcription.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 624-783 of human DDX21 (NP_004719.2).
Sequence VDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
Gene ID 9188
Swiss prot Q9NR30
Synonyms RH; GUA; GURDB; II/Gu; RH II/Gu; RH-II/GU; gu-alpha; RH-II/GuA; DDX21
Calculated MW 87kDa
Observed MW 100kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SW620, MCF7, HepG2, 293T, Mouse spleen, Mouse thymus
Cellular location Nucleus, nucleolus, nucleoplasm
Customer validation

WB (Homo sapiens, Rattus norvegicus)

immunoblotting (Mus musculus)

IF (Homo sapiens)

Research Area

DDX21 Rabbit pAb images

ABclonal:Western blot - DDX21 Rabbit pAb (A7034)}

Western blot - DDX21 Rabbit pAb (A7034)

Western blot analysis of extracts of various cell lines, using DDX21 antibody (A7034) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 60s.

Inquire About This Product

Submit your question about A7034 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DDX21. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DDX21. (Distance between topics and target gene indicate popularity.) DDX21

* Data provided by citexs.com, for reference only.

Publishing research using A7034? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order