Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

DDIT3/CHOP Rabbit pAb (A11346)

Publications (4) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - DDIT3/CHOP Rabbit pAb (A11346)

Western blot analysis of lysates from C6 cells, using DDIT3/CHOP Rabbit pAb (A11346) at 1:1000 dilution.C6 cells were treated by tunicamycin (2 μg/ml) for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - DDIT3/CHOP Rabbit pAb (A11346)

Immunohistochemistry analysis of DDIT3/CHOP in paraffin-embedded mouse spleen using DDIT3/CHOP Rabbit pAb (A11346) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - DDIT3/CHOP Rabbit pAb (A11346)

Immunohistochemistry analysis of DDIT3/CHOP in paraffin-embedded rat spleen using DDIT3/CHOP Rabbit pAb (A11346) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - DDIT3/CHOP Rabbit pAb (A11346)

Immunoprecipitation analysis of 300 μg extracts of C2C12 tunicamycin cells using 3 μg DDIT3/CHOP antibody (A11346). Western blot was performed from the immunoprecipitate using DDIT3/CHOP antibody (A11346) at a dilution of 1:500.

You may also interested in:

Overview

Product name DDIT3/CHOP Rabbit pAb
Catalog No. A11346
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDIT3/CHOP (NP_004074.2).
Sequence MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQG
Gene ID 1649
Swiss prot P35638
Synonyms CHOP; CEBPZ; CHOP10; CHOP-10; GADD153; AltDDIT3; C/EBPzeta; DDIT3/CHOP
Calculated MW 19kDa
Observed MW 30kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunoprecipitation    
Positive samples C6, C2C12
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Rattus norvegicus, Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DDIT3/CHOP Rabbit pAb images

ABclonal:Western blot - DDIT3/CHOP Rabbit pAb (A11346)}

Western blot - DDIT3/CHOP Rabbit pAb (A11346)

Western blot analysis of lysates from C6 cells, using DDIT3/CHOP Rabbit pAb (A11346) at 1:1000 dilution.C6 cells were treated by tunicamycin (2 μg/ml) for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - DDIT3/CHOP Rabbit pAb (A11346)}

Immunohistochemistry - DDIT3/CHOP Rabbit pAb (A11346)

Immunohistochemistry analysis of DDIT3/CHOP in paraffin-embedded mouse spleen using DDIT3/CHOP Rabbit pAb (A11346) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - DDIT3/CHOP Rabbit pAb (A11346)}

Immunohistochemistry - DDIT3/CHOP Rabbit pAb (A11346)

Immunohistochemistry analysis of DDIT3/CHOP in paraffin-embedded rat spleen using DDIT3/CHOP Rabbit pAb (A11346) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunoprecipitation - DDIT3/CHOP Rabbit pAb (A11346)}

Immunoprecipitation - DDIT3/CHOP Rabbit pAb (A11346)

Immunoprecipitation analysis of 300 μg extracts of C2C12 tunicamycin cells using 3 μg DDIT3/CHOP antibody (A11346). Western blot was performed from the immunoprecipitate using DDIT3/CHOP antibody (A11346) at a dilution of 1:500.

Inquire About This Product

Submit your question about A11346 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DDIT3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DDIT3. (Distance between topics and target gene indicate popularity.) DDIT3

* Data provided by citexs.com, for reference only.

Publishing research using A11346? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order