Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

DCN Rabbit pAb (A15048)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - DCN Rabbit pAb (A15048)

Western blot analysis of extracts of various cell lines, using DCN antibody (A15048) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Western blot - DCN Rabbit pAb (A15048)

Western blot analysis of extracts of HeLa cells, using DCN antibody (A15048) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - DCN Rabbit pAb (A15048)

Immunohistochemistry analysis of paraffin-embedded human colon using DCN Rabbit pAb (A15048) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - DCN Rabbit pAb (A15048)

Immunohistochemistry analysis of paraffin-embedded human placenta using DCN Rabbit pAb (A15048) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - DCN Rabbit pAb (A15048)

Immunohistochemistry analysis of paraffin-embedded human testis using DCN Rabbit pAb (A15048) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - DCN Rabbit pAb (A15048)

Immunofluorescence analysis of NIH-3T3 cells using DCN Rabbit pAb (A15048) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name DCN Rabbit pAb
Catalog No. A15048
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. This protein plays a role in collagen fibril assembly. Binding of this protein to multiple cell surface receptors mediates its role in tumor suppression, including a stimulatory effect on autophagy and inflammation and an inhibitory effect on angiogenesis and tumorigenesis. This gene and the related gene biglycan are thought to be the result of a gene duplication. Mutations in this gene are associated with congenital stromal corneal dystrophy in human patients.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 31-359 of human DCN (NP_001911.1).
Sequence DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Gene ID 1634
Swiss prot P07585
Synonyms CSCD; PG40; PGII; PGS2; DSPG2; SLRR1B; DCN
Calculated MW 40kDa
Observed MW 45kDa/48kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, Mouse heart, Rat heart
Cellular location Secreted, extracellular matrix, extracellular space

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DCN Rabbit pAb images

ABclonal:Western blot - DCN Rabbit pAb (A15048)}

Western blot - DCN Rabbit pAb (A15048)

Western blot analysis of extracts of various cell lines, using DCN antibody (A15048) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Western blot - DCN Rabbit pAb (A15048)}

Western blot - DCN Rabbit pAb (A15048)

Western blot analysis of extracts of HeLa cells, using DCN antibody (A15048) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - DCN Rabbit pAb (A15048)}

Immunohistochemistry - DCN Rabbit pAb (A15048)

Immunohistochemistry analysis of paraffin-embedded human colon using DCN Rabbit pAb (A15048) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - DCN Rabbit pAb (A15048)}

Immunohistochemistry - DCN Rabbit pAb (A15048)

Immunohistochemistry analysis of paraffin-embedded human placenta using DCN Rabbit pAb (A15048) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - DCN Rabbit pAb (A15048)}

Immunohistochemistry - DCN Rabbit pAb (A15048)

Immunohistochemistry analysis of paraffin-embedded human testis using DCN Rabbit pAb (A15048) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - DCN Rabbit pAb (A15048)}

Immunofluorescence - DCN Rabbit pAb (A15048)

Immunofluorescence analysis of NIH-3T3 cells using DCN Rabbit pAb (A15048) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15048 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DCN. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DCN. (Distance between topics and target gene indicate popularity.) DCN

* Data provided by citexs.com, for reference only.

Publishing research using A15048? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order