Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Cytokeratin 17 (KRT17) Rabbit mAb (A3769)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Cytokeratin 17 (KRT17) Rabbit mAb (A3769)

Western blot analysis of HeLa, using Cytokeratin 17 (KRT17) Rabbit mAb (A3769) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name Cytokeratin 17 (KRT17) Rabbit mAb
Catalog No. A3769
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0271

Background

This gene encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 17 (KRT17) (Q04695).
Sequence MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLD
Gene ID 3872
Swiss prot Q04695
Synonyms PC; K17; PC2; 39.1; CK-17; PCHC1; Cytokeratin 17 (KRT17)
Calculated MW 48kDa
Observed MW 48kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa
Cellular location Cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cytokeratin 17 (KRT17) Rabbit mAb images

ABclonal:Western blot - Cytokeratin 17 (KRT17) Rabbit mAb (A3769)}

Western blot - Cytokeratin 17 (KRT17) Rabbit mAb (A3769)

Western blot analysis of HeLa, using Cytokeratin 17 (KRT17) Rabbit mAb (A3769) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A3769 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KRT17. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KRT17. (Distance between topics and target gene indicate popularity.) KRT17

* Data provided by citexs.com, for reference only.

Publishing research using A3769? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order