Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cytokeratin 15 (KRT15) Rabbit pAb (A12155)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Cytokeratin 15 (KRT15) Rabbit pAb (A12155)

Western blot analysis of extracts of various cell lines, using Cytokeratin 15 (Cytokeratin 15 (KRT15)) antibody (A12155) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name Cytokeratin 15 (KRT15) Rabbit pAb
Catalog No. A12155
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human Cytokeratin 15 (Cytokeratin 15 (KRT15)) (NP_002266.2).
Sequence QLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVS
Gene ID 3866
Swiss prot P19012
Synonyms K15; CK15; K1CO; Cytokeratin 15 (KRT15)
Calculated MW 49kDa
Observed MW 49kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples BxPC-3, HeLa, Mouse pancreas, Rat thymus
Cellular location cytoskeleton, cytosol, extracellular exosome, nucleus

Research Area

Cytokeratin 15 (KRT15) Rabbit pAb images

ABclonal:Western blot - Cytokeratin 15 (KRT15) Rabbit pAb (A12155)}

Western blot - Cytokeratin 15 (KRT15) Rabbit pAb (A12155)

Western blot analysis of extracts of various cell lines, using Cytokeratin 15 (Cytokeratin 15 (KRT15)) antibody (A12155) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A12155 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KRT15. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KRT15. (Distance between topics and target gene indicate popularity.) KRT15

* Data provided by citexs.com, for reference only.

Publishing research using A12155? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order