Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Clusterin Rabbit pAb (A13479)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Clusterin Rabbit pAb (A13479)

Western blot analysis of extracts of various cell lines, using Clusterin Rabbit pAb (A13479) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - Clusterin Rabbit pAb (A13479)

Immunofluorescence analysis of U2OS cells using Clusterin Rabbit pAb (A13479). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Clusterin Rabbit pAb
Catalog No. A13479
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-449 of human Clusterin alpha chain (NP_976084.1).
Sequence FPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Gene ID 1191
Swiss prot P10909
Synonyms CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; Clusterin
Calculated MW 52kDa
Observed MW 38kDa/57kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HepG2, U-251MG, Human plasma, Mouse plasma
Cellular location Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Endoplasmic reticulum, Microsome, Mitochondrion membrane, Nucleus, Peripheral membrane protein, Secreted, chromaffin granule, cytosol, secretory vesicle
Customer validation

WB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Clusterin Rabbit pAb images

ABclonal:Western blot - Clusterin Rabbit pAb (A13479)}

Western blot - Clusterin Rabbit pAb (A13479)

Western blot analysis of extracts of various cell lines, using Clusterin Rabbit pAb (A13479) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - Clusterin Rabbit pAb (A13479)}

Immunofluorescence - Clusterin Rabbit pAb (A13479)

Immunofluorescence analysis of U2OS cells using Clusterin Rabbit pAb (A13479). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A13479 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CLU. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CLU. (Distance between topics and target gene indicate popularity.) CLU

* Data provided by citexs.com, for reference only.

Publishing research using A13479? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (2)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order